Enhanced Validation

Anti-BAG3 Antibody

BCL2-associated athanogene 3
References (1)
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human BAG3
Open Datasheet
Price
$450.00
Product Number
HPA018493
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemical staining of human cerebellum, prostate, skeletal muscle and skin using Anti-BAG3 antibody HPA018493 (A) shows similar protein distribution across tissues to independent antibody HPA020586 (B).
Show all images
[1 pictures]
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
BCL2-associated athanogene 3
Target Gene
BAG3
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000020298 (80%)

Mouse ENSMUSG00000030847 (77%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-BAG3 HPA020586.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA018493 on the Human Protein Atlas
Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA018493 on the Human Protein Atlas
Protein Name
BCL2-associated athanogene 3
Gene Name
BAG3
UniProt ID
O95817
Gene (Ensembl)
ENSG00000151929
Entrez Gene ID
Entrez gene: 9531
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000151929 on the Human Protein Atlas

Did we miss your publication?

Have you published using HPA018493? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Anti-BAG3 (HPA020586)
Corresponding Antigens
PrEST Antigen BAG3 (APrEST74209)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch