Enhanced Validation

Anti-ARID1A Antibody

AT rich interactive domain 1A (SWI-like)
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human ARID1A
Alternative Gene Names
B120, BAF250, BAF250a, C10rf4, C1orf4, P270, SMARCF1
Price
$437.00
Product Number
HPA005456
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
AT rich interactive domain 1A (SWI-like)
Target gene
ARID1A
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000007880 (95%)

Rat ENSRNOG00000006137 (88%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
AT rich interactive domain 1A (SWI-like)
Gene Name
ARID1A
Alternative Gene Names
B120, BAF250, BAF250a, C10rf4, C1orf4, P270, SMARCF1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000117713 on the Human Protein Atlas

Lindén M, Thomsen C, Grundevik P, Jonasson E, Andersson D, Runnberg R, Dolatabadi S, Vannas C, Luna Santamarίa M, Fagman H, Ståhlberg A, Åman P

FET family fusion oncoproteins target the SWI/SNF chromatin remodeling complex

EMBO Rep , 2019 Apr 8; 20(5):e45766. Epub 2019 Apr 8

PubMed ID: 30962207 DOI: 10.15252/embr.201845766

Ünçel M, Diniz G, Aköz G, Ekin ZY, Sayhan S, Yardım S, Salimoğlu S

Loss of Nuclear ARID-1A Expressions Is Associated with Hormone Receptor Status in Breast Cancers

Eur J Breast Health , 2019 Apr 1; 15(2):125-129. Epub 2019 Apr 1

PubMed ID: 31001615 DOI: 10.5152/ejbh.2019.4677

Zhou H, Tan S, Li H, Lin X

Expression and significance of EBV, ARID1A and PIK3CA in gastric carcinoma

Mol Med Rep , 2019 Jan 22; 19(3):2125-2136. Epub 2019 Jan 22

PubMed ID: 30747208 DOI: 10.3892/mmr.2019.9886

Khalique S, Naidoo K, Attygalle AD, Kriplani D, Daley F, Lowe A, Campbell J, Jones T, Hubank M, Fenwick K, Matthews N, Rust AG, Lord CJ, Banerjee S, Natrajan R

Optimised ARID1A immunohistochemistry is an accurate predictor of ARID1A mutational status in gynaecological cancers

J Pathol Clin Res , 2018 Jul 20; 4(3):154-166. Epub 2018 Jul 20

PubMed ID: 29659191 DOI: 10.1002/cjp2.103

Berns K, Caumanns JJ, Hijmans EM, Gennissen AM, Severson TM, Evers B, Wisman GB, Jan Meersma G, Lieftink C, Beijersbergen RL, Itamochi H, van der Zee AG, de Jong S, Bernards R

ARID1A mutation sensitizes most ovarian clear cell carcinomas to BET inhibitors

Oncogene , 2018 May 15; 37(33):4611-4625. Epub 2018 May 15

PubMed ID: 29760405 DOI: 10.1038/s41388-018-0300-6

Shahid M, Gull N, Yeon A, Cho E, Bae J, Yoon HS, You S, Yoon H, Kim M, Berman BP, Kim J

Alpha-oxoglutarate inhibits the proliferation of immortalized normal bladder epithelial cells via an epigenetic switch involving ARID1A

Sci Rep , 2018 Mar 14; 8:4505. Epub 2018 Mar 14

PubMed ID: 29540744 DOI: 10.1038/s41598-018-22771-2

Visser NC, van der Wurff AA, Pijnenborg JM, Massuger LF, Bulten J, Nagtegaal ID

Tissue microarray is suitable for scientific biomarkers studies in endometrial cancer

Virchows Arch , 2018 Feb 9; 472(3):407-413. Epub 2018 Feb 9

PubMed ID: 29426961 DOI: 10.1007/s00428-017-2289-6

Sun X, Wang SC, Wei Y, Luo X, Jia Y, Li L, Gopal P, Zhu M, Nassour I, Chuang JC, Maples T, Celen C, Nguyen LH, Wu L, Fu S, Li W, Hui L, Tian F, Ji Y, Zhang S, Sorouri M, Hwang TH, Letzig L, James L, Wang Z, Yopp A, Singal AG, Zhu H

Arid1a has context-dependent oncogenic and tumor suppressor functions in liver cancer

Cancer Cell , 2017 Nov 13; 32(5):574-589.e6

PubMed ID: 29136504 DOI: 10.1016/j.ccell.2017.10.007

Carlos Parra-Herran, Jordan Lerner-Ellis, Bin Xu, Sam Khalouei, Dina Bassiouny, Matthew Cesari, Nadia Ismiil, Sharon Nofech-Mozes

Molecular-based classification algorithm for endometrial carcinoma categorizes ovarian endometrioid carcinoma into prognostically significant groups

Modern Pathology , August 04, 2017

DOI: 10.1038/modpathol.2017.81

Anglesio MS, Papadopoulos N, Ayhan A, Nazeran TM, Noë M, Horlings HM, Lum A, Jones S, Senz J, Seckin T, Ho J, Wu RC, Lac V, Ogawa H, Tessier-Cloutier B, Alhassan R, Wang A, Wang Y, Cohen JD, Wong F, Hasanovic A, Orr N, Zhang M, Popoli M, McMahon W, Wood LD, Mattox A, Allaire C, Segars J, Williams C, Tomasetti C, Boyd N, Kinzler KW, Gilks CB, Diaz L, Wang TL, Vogelstein B, Yong PJ, Huntsman DG, Shih IM

Cancer-Associated Mutations in Endometriosis without Cancer

N Engl J Med , 2017 May 11; 376(19):1835-1848

PubMed ID: 28489996 DOI: 10.1056/NEJMoa1614814

Jiang W, Dulaimi E, Devarajan K, Parsons T, Wang Q, O'Neill R, Solomides C, Peiper SC, Testa JR, Uzzo R, Yang H

Intratumoral heterogeneity analysis reveals hidden associations between protein expression losses and patient survival in clear cell renal cell carcinoma

Oncotarget , 2017 Apr 8; 8(23):37423-37434. Epub 2017 Apr 8

PubMed ID: 28445125 DOI: 10.18632/oncotarget.16965

Nastase A, Teo JY, Heng HL, Ng CC, Myint SS, Rajasegaran V, Loh JL, Lee SY, Ooi LL, Chung AY, Chow PK, Cheow PC, Wan WK, Azhar R, Khoo A, Xiu SX, Alkaff SM, Cutcutache I, Lim JQ, Ong CK, Herlea V, Dima S, Duda DG, Teh BT, Popescu I, Lim TK

Genomic and proteomic characterization of ARID1A chromatin remodeller in ampullary tumors

Am J Cancer Res , 2017 Mar 1; 7(3):484-502. Epub 2017 Mar 1

PubMed ID: 28401006

Walter DM, Venancio OS, Buza EL, Tobias JW, Deshpande C, Gudiel AA, Kim-Kiselak C, Cicchini M, Yates TJ, Feldser DM

Systematic in vivo inactivation of chromatin regulating enzymes identifies Setd2 as a potent tumor suppressor in lung adenocarcinoma

Cancer Res , 2017 Feb 15; 77(7):1719-1729. Epub 2017 Feb 15

PubMed ID: 28202515 DOI: 10.1158/0008-5472.CAN-16-2159

Howitt BE, Strickland KC, Sholl LM, Rodig S, Ritterhouse LL, Chowdhury D, D'Andrea AD, Matulonis UA, Konstantinopoulos PA

Clear cell ovarian cancers with microsatellite instability: A unique subset of ovarian cancers with increased tumor-infiltrating lymphocytes and PD-1/PD-L1 expression

Oncoimmunology , 2017 Jan 6; 6(2):e1277308. Epub 2017 Jan 6

PubMed ID: 28344892 DOI: 10.1080/2162402X.2016.1277308

Valtcheva N, Lang FM, Noske A, Samartzis EP, Schmidt AM, Bellini E, Fink D, Moch H, Rechsteiner M, Dedes KJ, Wild PJ

Tracking the origin of simultaneous endometrial and ovarian cancer by next-generation sequencing – a case report

BMC Cancer , 2017 Jan 19; 17:66. Epub 2017 Jan 19

PubMed ID: 28103826 DOI: 10.1186/s12885-017-3054-6

Jiang W, Dulaimi E, Devarajan K, Parsons T, Wang Q, Liao L, Cho EA, O'Neill R, Solomides C, Peiper SC, Testa JR, Uzzo R, Yang H

Immunohistochemistry Successfully Uncovers Intratumoral Heterogeneity and Widespread Co-Losses of Chromatin Regulators in Clear Cell Renal Cell Carcinoma

PLoS One , 2016 Oct 20; 11(10):e0164554. Epub 2016 Oct 20

PubMed ID: 27764136 DOI: 10.1371/journal.pone.0164554

Mackenzie Coatham, Xiaodong Li, Anthony N Karnezis, Lien N Hoang, Basile Tessier-Cloutier, Bo Meng, Robert A Soslow, C Blake Gilks, David G Huntsman, Colin J R Stewart, Lynne M Postovit, Martin Köbel, Cheng-Han Lee

Concurrent ARID1A and ARID1B inactivation in endometrial and ovarian dedifferentiated carcinomas

Modern Pathology , August 26, 2016

DOI: 10.1038/modpathol.2016.156

Rosa-Rosa JM, Leskelä S, Cristóbal-Lana E, Santón A, López-García MA, Muñoz G, Pérez-Mies B, Biscuola M, Prat J, Oliva E, Soslow RA, Matias-Guiu X, Palacios J

Molecular genetic heterogeneity in undifferentiated endometrial carcinomas

Mod Pathol , 2016 Aug 5; 29(11):1390-1398. Epub 2016 Aug 5

PubMed ID: 27491810 DOI: 10.1038/modpathol.2016.132

Llorca-Cardeñosa MJ, Fleitas T, Ibarrola-Villava M, Peña-Chilet M, Mongort C, Martinez-Ciarpaglini C, Navarro L, Gambardella V, Castillo J, Roselló S, Navarro S, Ribas G, Cervantes A

Epigenetic changes in localized gastric cancer: the role of RUNX3 in tumor progression and the immune microenvironment

Oncotarget , 2016 Aug 23; 7(39):63424-63436. Epub 2016 Aug 23

PubMed ID: 27566570 DOI: 10.18632/oncotarget.11520

Rahmanto YS, Jung JG, Wu RC, Kobayashi Y, Heaphy CM, Meeker AK, Wang TL, Shih IM

Inactivating ARID1A Tumor Suppressor Enhances TERT Transcription and Maintains Telomere Length in Cancer Cells

J Biol Chem , 2016 Mar 7; 291(18):9690-9699. Epub 2016 Mar 7

PubMed ID: 26953344 DOI: 10.1074/jbc.M115.707612

Sun X, Chuang JC, Kanchwala M, Wu L, Celen C, Li L, Liang H, Zhang S, Maples T, Nguyen LH, Wang SC, Signer RA, Sorouri M, Nassour I, Liu X, Xu J, Wu M, Zhao Y, Kuo YC, Wang Z, Xing C, Zhu H

Suppression of the SWI/SNF component Arid1a promotes mammalian regeneration

Cell Stem Cell , 2016 Mar 24; 18(4):456-466. Epub 2016 Mar 24

PubMed ID: 27044474 DOI: 10.1016/j.stem.2016.03.001

Lee LH, Sadot E, Ivelja S, Vakiani E, Hechtman JF, Sevinsky CJ, Klimstra DS, Ginty F, Shia J

ARID1A expression in early stage colorectal adenocarcinoma: an exploration of its prognostic significance

Hum Pathol , 2016 Mar 2; 53:97-104. Epub 2016 Mar 2

PubMed ID: 26980037 DOI: 10.1016/j.humpath.2016.02.004

Abe H, Hayashi A, Kunita A, Sakamoto Y, Hasegawa K, Shibahara J, Kokudo N, Fukayama M

Altered expression of AT-rich interactive domain 1A in hepatocellular carcinoma

Int J Clin Exp Pathol , 2015; 8(3):2763-2770. Epub 2015 Mar 1

PubMed ID: 26045782

Uehara Y, Oda K, Ikeda Y, Koso T, Tsuji S, Yamamoto S, Asada K, Sone K, Kurikawa R, Makii C, Hagiwara O, Tanikawa M, Maeda D, Hasegawa K, Nakagawa S, Wada-Hiraike O, Kawana K, Fukayama M, Fujiwara K, Yano T, Osuga Y, Fujii T, Aburatani H

Integrated Copy Number and Expression Analysis Identifies Profiles of Whole-Arm Chromosomal Alterations and Subgroups with Favorable Outcome in Ovarian Clear Cell Carcinomas

PLoS One , 2015; 10(6):e0128066. Epub 2015 Jun 4

PubMed ID: 26043110 DOI: 10.1371/journal.pone.0128066

Ibarrola-Villava M, Llorca-Cardeñosa MJ, Tarazona N, Mongort C, Fleitas T, Perez-Fidalgo JA, Roselló S, Navarro S, Ribas G, Cervantes A

Deregulation of ARID1A, CDH1, cMET and PIK3CA and target-related microRNA expression in gastric cancer

Oncotarget , 2015 Sep 29; 6(29):26935-26945. Epub 2015 Jul 27

PubMed ID: 26334097 DOI: 10.18632/oncotarget.4775

Ayhan A, Mao T, Suryo Rahmanto Y, Zeppernick F, Ogawa H, Wu R, Wang T, Shih I

Increased proliferation in atypical hyperplasia/endometrioid intraepithelial neoplasia of the endometrium with concurrent inactivation of ARID1A and PTEN tumour suppressors

J Pathol Clin Res , 2015 May 27; 1(3):186-193. Epub 2015 May 27

PubMed ID: 27499903 DOI: 10.1002/cjp2.22

He F, Li J, Xu J, Zhang S, Xu Y, Zhao W, Yin Z, Wang X

Decreased expression of ARID1A associates with poor prognosis and promotes metastases of hepatocellular carcinoma

J Exp Clin Cancer Res , 2015 May 15; 34(1):47. Epub 2015 May 15

PubMed ID: 25975202 DOI: 10.1186/s13046-015-0164-3

Faraj SF, Chaux A, Gonzalez-Roibon N, Munari E, Cubilla AL, Shih IM, Netto GJ

Immunohistochemical expression of ARID1A in penile squamous cell carcinomas: a tissue microarray study of 112 cases

Hum Pathol , 2015/05/01; 46(5):761-766. Epub 2015 Feb 12

PubMed ID: 25776029 DOI: 10.1016/j.humpath.2015.01.018

Benjamin G Bitler, Katherine M Aird, Azat Garipov, Hua Li, Michael Amatangelo, Andrew V Kossenkov, David C Schultz, Qin Liu, Ie-Ming Shih, Jose R Conejo-Garcia, David W Speicher, Rugang Zhang

Synthetic lethality by targeting EZH2 methyltransferase activity in ARID1A-mutated cancers

Nature Medicine , February 16, 2015

PubMed ID: 25686104 DOI: 10.1038/nm.3799

Inada R, Sekine S, Taniguchi H, Tsuda H, Katai H, Fujiwara T, Kushima R

ARID1A expression in gastric adenocarcinoma: Clinicopathological significance and correlation with DNA mismatch repair status

World J Gastroenterol , 2015 Feb 21; 21(7):2159-2168. Epub 2015 Feb 21

PubMed ID: 25717252 DOI: 10.3748/wjg.v21.i7.2159

Howat W, Miller J, Gounaris I

Application of ARID1A to murine formalin-fixed paraffin embedded tissue using immunohistochemistry

F1000Res , 2014; 3:244. Epub 2015 Jan 6

PubMed ID: 25653835 DOI: 10.12688/f1000research.5514.1

Wu RC, Ayhan A, Maeda D, Kim KR, Clarke BA, Shaw P, Chui MH, Rosen B, Shih IM, Wang TL

Frequent somatic mutations of the telomerase reverse transcriptase promoter in ovarian clear cell carcinoma but not in other major types of gynecologic malignancies

J Pathol , 2014 Mar; 232(4):473-481

PubMed ID: 24338723 DOI: 10.1002/path.4315

Wiegand KC, Hennessy BT, Leung S, Wang Y, Ju Z, McGahren M, Kalloger SE, Finlayson S, Stemke-Hale K, Lu Y, Zhang F, Anglesio MS, Gilks B, Mills GB, Huntsman DG, Carey MS

A functional proteogenomic analysis of endometrioid and clear cell carcinomas using reverse phase protein array and mutation analysis: protein expression is histotype-specific and loss of ARID1A/BAF250a is associated with AKT phosphorylation

BMC Cancer , 2014 Feb 22; 14:120. Epub 2014 Feb 22

PubMed ID: 24559118 DOI: 10.1186/1471-2407-14-120

Streppel M, Lata S, DelaBastide M, Montgomery E, Wang J, Canto M, Macgregor-Das A, Pai S, Morsink F, Offerhaus G, Antoniou E, Maitra A, McCombie W

Next-generation sequencing of endoscopic biopsies identifies ARID1A as a tumor-suppressor gene in Barrett’s esophagus

Oncogene , 2014 Jan 16; 33(3):347-357. Epub 2013 Jan 14

PubMed ID: 23318448 DOI: 10.1038/onc.2012.586

Hsien-Neng Huang, Ming-Chieh Lin, Wen-Chih Huang, Ying-Cheng Chiang, Kuan-Ting Kuo

Loss of ARID1A expression and its relationship with PI3K-Akt pathway alterations and ZNF217 amplification in ovarian clear cell carcinoma

Modern Pathology , 27, 983-990 (2013)

PubMed ID: 0 DOI: 10.1038/modpathol.2013.216

Mao TL, Ardighieri L, Ayhan A, Kuo KT, Wu CH, Wang TL, Shih IM

Loss of ARID1A Expression Correlates with Stages of Tumor Progression in Uterine Endometrioid Carcinoma

Am J Surg Pathol , 2013 Sep; 37(9):1342-1348

PubMed ID: 24076775 DOI: 10.1097/PAS.0b013e3182889dc3

Xiao W, Awadallah A, Xin W

Loss of ARID1A/BAF250a expression in ovarian endometriosis and clear cell carcinoma

Int J Clin Exp Pathol , 2012; 5(7):642-650. Epub 2012 Sep 5

PubMed ID: 22977660

Ayhan A, Mao TL, Seckin T, Wu CH, Guan B, Ogawa H, Futagami M, Mizukami H, Yokoyama Y, Kurman RJ, Shih IM

Loss of ARID1A expression is an early molecular event in tumor progression from ovarian endometriotic cyst to clear cell and endometrioid carcinoma

Int J Gynecol Cancer , 2012 Oct; 22(8):1310-1315

PubMed ID: 22976498 DOI: 10.1097/IGC.0b013e31826b5dcc

Guan B, Gao M, Wu CH, Wang TL, Shih IM

Functional Analysis of In-frame Indel ARID1A Mutations Reveals New Regulatory Mechanisms of Its Tumor Suppressor Functions

Neoplasia , 2012 Oct; 14(10):986-993

PubMed ID: 23097632 DOI: 10.1593/neo.121218

Wu CH, Mao TL, Vang R, Ayhan A, Wang TL, Kurman RJ, Shih IM

Endocervical-type Mucinous Borderline Tumors are Related to Endometrioid Tumors Based on Mutation and Loss of Expression of ARID1A

Int J Gynecol Pathol , 2012 Jul; 31(4):297-303

PubMed ID: 22653341 DOI: 10.1097/PGP.0b013e31823f8482

Yamamoto S, Tsuda H, Takano M, Tamai S, Matsubara O

Loss of ARID1A protein expression occurs as an early event in ovarian clear-cell carcinoma development and frequently coexists with PIK3CA mutations.

Mod Pathol , 2012 Apr; 25(4):615-24. Epub 2011 Dec 9

PubMed ID: 22157930 DOI: 10.1038/modpathol.2011.189

Yamamoto S, Tsuda H, Takano M, Tamai S, Matsubara O

PIK3CA mutations and loss of ARID1A protein expression are early events in the development of cystic ovarian clear cell adenocarcinoma.

Virchows Arch , 2012 Jan; 460(1):77-87. Epub 2011 Nov 26

PubMed ID: 22120431 DOI: 10.1007/s00428-011-1169-8

Weigert O, Kopp N, Lane AA, Yoda A, Dahlberg SE, Neuberg D, Bahar AY, Chapuy B, Kutok JL, Longtine J, Kuo FC, Haley T, Salois M, Sullivan TJ, Fisher DC, Fox EA, Rodig SJ, Antin JH, Weinstock DM

Molecular ontogeny of donor-derived follicular lymphomas occurring after hematopoietic cell transplantation

Cancer Discov , 2012 Jan; 2(1):47-55. Epub 2011 Dec 12

PubMed ID: 22585168 DOI: 10.1158/2159-8290.CD-11-0208

Wang K, Kan J, Yuen ST, Shi ST, Chu KM, Law S, Chan TL, Kan Z, Chan AS, Tsui WY, Lee SP, Ho SL, Chan AK, Cheng GH, Roberts PC, Rejto PA, Gibson NW, Pocalyko DJ, Mao M, Xu J, Leung SY

Exome sequencing identifies frequent mutation of ARID1A in molecular subtypes of gastric cancer.

Nat Genet , 2011 Oct 30; 43(12):1219-23. Epub 2011 Oct 30

PubMed ID: 22037554 DOI: 10.1038/ng.982

Guan B, Mao TL, Panuganti PK, Kuhn E, Kurman RJ, Maeda D, Chen E, Jeng YM, Wang TL, Shih IM

Mutation and loss of expression of ARID1A in uterine low-grade endometrioid carcinoma

Am J Surg Pathol , 2011 May; 35(5):625-632

PubMed ID: 21412130 DOI: 10.1097/PAS.0b013e318212782a

Did we miss your publication?

Have you published using HPA005456? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch