Enhanced Validation

Anti-ARG1 Antibody

arginase 1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human ARG1
Price
$450.00
Product Number
HPA003595
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
arginase 1
Target Gene
ARG1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000019987 (82%)

Rat ENSRNOG00000013304 (81%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:2500 - 1:5000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Protein Name
arginase 1
Gene Name
ARG1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000118520 on the Human Protein Atlas

Vacas A, Fernández-Rubio C, Larrea E, Peña-Guerrero J, Nguewa PA

LmjF.22.0810 from Leishmania major Modulates the Th2-Type Immune Response and Is Involved in Leishmaniasis Outcome

Biomedicines , 2020 Oct 26; 8(11):452. Epub 2020 Oct 26

PubMed ID: 33114674 DOI: 10.3390/biomedicines8110452

Iwaya M, Riddell R, Asano K, Kobayashi K, Uehara T, Ota H

Alpha-Fetoprotein-Producing Early Gastric Cancer with Intramucosal Hepatoid and Fetal Enteric Differentiation

Case Rep Gastroenterol , 2020 Aug 26; 14(2):426-435. Epub 2020 Aug 26

PubMed ID: 32999644 DOI: 10.1159/000508413

Barboza TC, Sotto MN, Kanashiro-Galo L, de Brito AC, Duarte MI, Quaresma JA, Pagliari C

M2-Polarized Macrophages Determine Human Cutaneous Lesions in Lacaziosis

Mycopathologia , . Epub 2020 May 6

PubMed ID: 32378114 DOI: 10.1007/s11046-020-00450-z

Venè R, Costa D, Augugliaro R, Carlone S, Scabini S, Casoni Pattacini G, Boggio M, Zupo S, Grillo F, Mastracci L, Pitto F, Minghelli S, Ferrari N, Tosetti F, Romairone E, Mingari MC, Poggi A, Benelli R

Evaluation of Glycosylated PTGS2 in Colorectal Cancer for NSAIDS-Based Adjuvant Therapy

Cells , 2020 Mar 11; 9(3):683. Epub 2020 Mar 11

PubMed ID: 32168749 DOI: 10.3390/cells9030683

Romano A, Parrinello NL, Simeon V, Puglisi F, La Cava P, Bellofiore C, Giallongo C, Camiolo G, D’Auria F, Grieco V, Larocca F, Barbato A, Cambria D, La Spina E, Tibullo D, Palumbo GA, Conticello C, Musto P, Di Raimondo F

High-density neutrophils in MGUS and multiple myeloma are dysfunctional and immune-suppressive due to increased STAT3 downstream signaling

Sci Rep , 2020 Feb 6; 10:1983. Epub 2020 Feb 6

PubMed ID: 32029833 DOI: 10.1038/s41598-020-58859-x

Puglisi F, Parrinello NL, Giallongo C, Cambria D, Camiolo G, Bellofiore C, Conticello C, Del Fabro V, Leotta V, Markovic U, Sapienza G, Barbato A, Scalese S, Tibullo D, Brundo MV, Palumbo GA, Di Raimondo F, Romano A

Plasticity of High-Density Neutrophils in Multiple Myeloma is Associated with Increased Autophagy Via STAT3

Int J Mol Sci , 2019 Jul 19; 20(14):3548. Epub 2019 Jul 19

PubMed ID: 32565533 DOI: 10.3390/ijms20143548

Romano A, Parrinello NL, Vetro C, Tibullo D, Giallongo C, La Cava P, Chiarenza A, Motta G, Caruso AL, Villari L, Tripodo C, Cosentino S, Ippolito M, Consoli U, Gallamini A, Pileri S, Di Raimondo F

The prognostic value of the myeloid-mediated immunosuppression marker Arginase-1 in classic Hodgkin lymphoma

Oncotarget , 2016 Sep 14; 7(41):67333-67346. Epub 2016 Sep 14

PubMed ID: 27637084 DOI: 10.18632/oncotarget.12024

Yang J, Gonon AT, Sjöquist PO, Lundberg JO, Pernow J

Arginase regulates red blood cell nitric oxide synthase and export of cardioprotective nitric oxide bioactivity

Proc Natl Acad Sci U S A , 2013 Sep 10; 110(37):15049-15054. Epub 2013 Aug 26

PubMed ID: 23980179 DOI: 10.1073/pnas.1307058110

Shemyakin A, Kövamees O, Rafnsson A, Böhm F, Svenarud P, Settergren M, Jung C, Pernow J

Arginase inhibition improves endothelial function in patients with coronary artery disease and type 2 diabetes mellitus.

Circulation , 2012 Dec 18; 126(25):2943-50. Epub 2012 Nov 26

PubMed ID: 23183942 DOI: 10.1161/CIRCULATIONAHA.112.140335

Gonon AT, Jung C, Katz A, Westerblad H, Shemyakin A, Sjöquist PO, Lundberg JO, Pernow J

Local Arginase Inhibition during Early Reperfusion Mediates Cardioprotection via Increased Nitric Oxide Production

PLoS One , 2012; 7(7):e42038. Epub 2012 Jul 31

PubMed ID: 22860052 DOI: 10.1371/journal.pone.0042038

Grönros J, Jung C, Lundberg JO, Cerrato R, Ostenson CG, Pernow J

Arginase inhibition restores in vivo coronary microvascular function in type 2 diabetic rats.

Am J Physiol Heart Circ Physiol , 2011 Apr; 300(4):H1174-81. Epub 2011 Feb 4

PubMed ID: 21297024 DOI: 10.1152/ajpheart.00560.2010

Yan BC, Gong C, Song J, Krausz T, Tretiakova M, Hyjek E, Al-Ahmadie H, Alves V, Xiao SY, Anders RA, Hart JA

Arginase-1: A New Immunohistochemical Marker of Hepatocytes and Hepatocellular Neoplasms

Am J Surg Pathol , 2010 Aug; 34(8):1147-1154

PubMed ID: 20661013 DOI: 10.1097/PAS.0b013e3181e5dffa

Chaerkady R, Harsha HC, Nalli A, Gucek M, Vivekanandan P, Akhtar J, Cole RN, Simmers J, Schulick RD, Singh S, Torbenson M, Pandey A, Thuluvath PJ

A Quantitative Proteomic Approach for Identification of Potential Biomarkers in Hepatocellular Carcinoma

J Proteome Res , 2008 Oct; 7(10):4289-4298. Epub 2008 Aug 21

PubMed ID: 18715028 DOI: 10.1021/pr800197z

Did we miss your publication?

Have you published using HPA003595? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch