Polyclonal Anti-AKT3 Antibody

v-akt murine thymoma viral oncogene homolog 3
References (4)
Recommended Applications
Product Description
Polyclonal Antibody against Human AKT3
Alternative Gene Names
PKBG, PRKBG, RAC-gamma
Open Datasheet
Price
$505.00
Product Number
HPA026441
Unit Size
Concentration
Lot dependent
Availability
4 in Stock
Ships
Ready to Ship
Show all images
[1 pictures]
Immunohistochemical staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.
Show all images
[1 pictures]
Western blot analysis in human cell line SH-SY5Y.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
v-akt murine thymoma viral oncogene homolog 3
Target Gene
AKT3
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
EEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLL
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000019699 (100%)

Rat ENSRNOG00000021497 (100%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)
All IHC characterization data in 44 normal tissues and 20 cancers for HPA026441 on the Human Protein Atlas
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
v-akt murine thymoma viral oncogene homolog 3
Gene Name
AKT3
Alternative Gene Names
PKBG, PRKBG, RAC-gamma
UniProt ID
Q9Y243
Gene (Ensembl)
ENSG00000117020
Entrez Gene ID
Entrez gene: 10000
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000117020 on the Human Protein Atlas

O'Hurley G, Daly E, O'Grady A, Cummins R, Quinn C, Flanagan L, Pierce A, Fan Y, Lynn MA, Rafferty M, Fitzgerald D, Pontén F, Duffy MJ, Jirström K, Kay EW, Gallagher WM

Investigation of molecular alterations of AKT-3 in triple-negative breast cancer.

Histopathology , 2014 Apr; 64(5):660-70. Epub 2013 Dec 12

PubMed ID: 24138071 DOI: 10.1111/his.12313

Stadler C, Rexhepaj E, Singan VR, Murphy RF, Pepperkok R, Uhlén M, Simpson JC, Lundberg E

Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells.

Nat Methods , 2013 Apr; 10(4):315-23. Epub 2013 Feb 24

PubMed ID: 23435261 DOI: 10.1038/nmeth.2377

Vredeveld LC, Possik PA, Smit MA, Meissl K, Michaloglou C, Horlings HM, Ajouaou A, Kortman PC, Dankort D, McMahon M, Mooi WJ, Peeper DS

Abrogation of BRAFV600E-induced senescence by PI3K pathway activation contributes to melanomagenesis

Genes Dev , 2012 May 15; 26(10):1055-1069

PubMed ID: 22549727 DOI: 10.1101/gad.187252.112

Did we miss your publication?

Have you published using HPA026441? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens
PrEST Antigen AKT3 (APrEST77824)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch