Enhanced Validation

Anti-AHCY Antibody

adenosylhomocysteinase
Recommended Applications
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human AHCY
Alternative Gene Names
SAHH
Price
$437.00
Product Number
HPA044675
Unit Size
100 µl
Concentration
Lot dependent
Availability
5 in Stock
Ships
Ready to Ship
Target protein
adenosylhomocysteinase
Target gene
AHCY
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
HPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHY
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000017777 (96%)

Mouse ENSMUSG00000048087 (96%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Western Blot (WB)

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Protein Name
adenosylhomocysteinase
Gene Name
AHCY
Alternative Gene Names
SAHH
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000101444 on the Human Protein Atlas

Danielsson F, Wiking M, Mahdessian D, Skogs M, Ait Blal H, Hjelmare M, Stadler C, Uhlén M, Lundberg E

RNA deep sequencing as a tool for selection of cell lines for systematic subcellular localization of all human proteins.

J Proteome Res , 2013 Jan 4; 12(1):299-307. Epub 2012 Dec 20

PubMed ID: 23227862 DOI: 10.1021/pr3009308

Did we miss your publication?

Have you published using HPA044675? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch