Enhanced Validation

Anti-ACSL1 Antibody

acyl-CoA synthetase long-chain family member 1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human ACSL1
Alternative Gene Names
ACS1, FACL1, FACL2, LACS, LACS1, LACS2
Price
$437.00
Product Number
HPA011316
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
acyl-CoA synthetase long-chain family member 1
Target gene
ACSL1
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
YATRPKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSE
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000018796 (79%)

Rat ENSRNOG00000010633 (76%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Immunohistochemistry (IHC)

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-ACSL1 HPA011964.

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Protein Name
acyl-CoA synthetase long-chain family member 1
Gene Name
ACSL1
Alternative Gene Names
ACS1, FACL1, FACL2, LACS, LACS1, LACS2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000151726 on the Human Protein Atlas

Did we miss your publication?

Have you published using HPA011316? Please let us know and we will be happy to include your reference on this page.

Read more

Human Protein Atlas Formal Validation Data - Orthogonal Strategies

Contribution from The Human Protein Atlas (proteinatlas.org) — December 04, 2016

Validation of Anti-ASCL1 antibody (HPA011316) was performed by comparing immunohistochemical staining intensities with RNA Seq data in the same samples.

Antibody validation using orthogonal strategies; comparing RNA and protein expression.

Pearson correlation >0.6 for RNA and protein expression (based on immunohistochemical stainings) in cell lines using Anti-ASCL1 Antibody (HPA011316).

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens