1. Home
  2. Products
  3. Primary Antibodies
  4. PrecisA Monoclonals
  5. Anti-TH

Anti-TH Antibody

tyrosine hydroxylase
References (3)
Recommended Applications
Product Description
Monoclonal Antibody against Human TH
Alternative Gene Names
DYT5b
Open Datasheet
Price
$437.00
Product Number
AMAb91112
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Show all images
[7 pictures]
Immunohistochemical staining of rat locus coeruleus shows strong cytoplasmic immunoreactivity in monoaminergic neurons.

Human Protein Atlas

View this protein on the Human Protein Atlas
Target protein
tyrosine hydroxylase
Target gene
TH
Belongs to Antibody panel
Neuroscience Markers
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000020410 (88%)

Mouse ENSMUSG00000000214 (88%)

Clonality
Monoclonal
Clone ID
CL3049
Isotype
IgG1
Host
MOUSE
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Protein A purified
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Protocols
View all protocols
Protein Name
tyrosine hydroxylase
Gene Name
TH
Alternative Gene Names
DYT5b
UniProt ID
P07101
Gene (Ensembl)
ENSG00000180176
Entrez Gene ID
Entrez gene: 7054
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Zhang L, Hao J, Zheng Y, Su R, Liao Y, Gong X, Liu L, Wang X

Fucoidan Protects Dopaminergic Neurons by Enhancing the Mitochondrial Function in a Rotenone-induced Rat Model of Parkinson’s Disease

Aging Dis , 2018 Aug 1; 9(4):590-604. Epub 2018 Aug 1

PubMed ID: 30090649 DOI: 10.14336/AD.2017.0831

Wang Y, Wang Y, Liu J, Wang X

Electroacupuncture Alleviates Motor Symptoms and Up-Regulates Vesicular Glutamatergic Transporter 1 Expression in the Subthalamic Nucleus in a Unilateral 6-Hydroxydopamine-Lesioned Hemi-Parkinsonian Rat Model

Neurosci Bull , 2018 Mar 5; 34(3):476-484. Epub 2018 Mar 5

PubMed ID: 29508251 DOI: 10.1007/s12264-018-0213-y

Salama M, Sobh M, Emam M, Abdalla A, Sabry D, El-Gamal M, Lotfy A, El-Husseiny M, Sobh M, Shalash A, Mohamed WM

Effect of intranasal stem cell administration on the nigrostriatal system in a mouse model of Parkinson's disease

Exp Ther Med , 2017 Jan 20; 13(3):976-982. Epub 2017 Jan 20

PubMed ID: 28450929 DOI: 10.3892/etm.2017.4073

Did we miss your publication?

Have you published using AMAb91112? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Anti-TH (HPA061003)
Corresponding Antigens
PrEST Antigen TH (APrEST87899)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch
  1. Home
  2. Products
  3. Primary Antibodies
  4. PrecisA Monoclonals
  5. Anti-TH