Enhanced Validation

Anti-SLC22A2 Antibody

solute carrier family 22 (organic cation transporter), member 2
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Monoclonal Antibody against Human SLC22A2
Alternative Gene Names
OCT2
Price
$437.00
Product Number
AMAb90791
Unit Size
100 µl
Concentration
Lot dependent
Availability
4 in Stock
Ships
Ready to Ship
Target protein
solute carrier family 22 (organic cation transporter), member 2
Target gene
SLC22A2
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR
Epitope
Binds to an epitope located within the peptide sequence KNAEAMRIIKHIAKK as determined by overlapping synthetic peptides.
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000040966 (84%)

Rat ENSRNOG00000016625 (77%)

Clonality
Monoclonal
Clone ID
CL0628
Isotype
IgG1
Host
Mouse
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Protein A purified
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
solute carrier family 22 (organic cation transporter), member 2
Gene Name
SLC22A2
Alternative Gene Names
OCT2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Did we miss your publication?

Have you published using AMAb90791? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch