Anti-MKI67IP Antibody

nucleolar protein interacting with the FHA domain of MKI67
Recommended Applications
Product Description
Monoclonal Antibody against Human NIFK
Alternative Gene Names
NIFK, hNIFK, Nopp34
Price
$437.00
Product Number
AMAb90961
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
nucleolar protein interacting with the FHA domain of MKI67
Target gene
NIFK
Belongs to Antibody panel
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI
Epitope
Binds to an epitope located within the peptide sequence KVSGTLDTPE as determined by overlapping synthetic peptides.
Verified Species Reactivity
Human
Clonality
Monoclonal
Clone ID
CL2240
Isotype
IgG2a
Host
Mouse
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Protein A purified
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Protein Name
nucleolar protein interacting with the FHA domain of MKI67
Gene Name
NIFK
Alternative Gene Names
NIFK, hNIFK, Nopp34
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Did we miss your publication?

Have you published using AMAb90961? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch