1. Home
  2. Products
  3. Primary Antibodies
  4. PrecisA Monoclonals
  5. Anti-CD68
Enhanced Validation

Anti-CD68 Antibody

CD68 molecule
References (1)
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Monoclonal Antibody against Human CD68
Alternative Gene Names
DKFZp686M18236, GP110, LAMP4, macrosialin, SCARD1
Open Datasheet
Price
$445.00
Product Number
AMAb90874
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Show all images
[4 pictures]
Immunohistochemical staining of human tonsil shows strong immunoreactivity in a subset of lymphoid cells.
Show all images
[2 pictures]
Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1, using Anti-CD68 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Human Protein Atlas

View this protein on the Human Protein Atlas
Target protein
CD68 molecule
Target gene
CD68
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG
Epitope
Binds to an epitope located within the peptide sequence SPTSKETIGDYTWTN as determined by overlapping synthetic peptides.
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000018774 (76%)

Rat ENSRNOG00000037563 (76%)

Clonality
Monoclonal
Clone ID
CL1346
Isotype
IgG1
Host
Mouse
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Protein A purified
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 1 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)
All IHC characterization data in 44 normal tissues and 20 cancers for AMAb90874 on the Human Protein Atlas
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
CD68 molecule
Gene Name
CD68
Alternative Gene Names
DKFZp686M18236, GP110, LAMP4, macrosialin, SCARD1
UniProt ID
P34810
Gene (Ensembl)
ENSG00000129226
Entrez Gene ID
Entrez gene: 968
Shipping
Normally shipped at ambient temperature.
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Lindskog C, Asplund A, Catrina A, Nielsen S, Rützler M

A Systematic Characterization of Aquaporin-9 Expression in Human Normal and Pathological Tissues

J Histochem Cytochem , 2016 Mar 29; 64(5):287-300. Epub 2016 Mar 29

PubMed ID: 27026296 DOI: 10.1369/0022155416641028

Did we miss your publication?

Have you published using AMAb90874? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Anti-CD68 (AMAb90873)
Anti-CD68 (HPA048982)
Corresponding Antigens
PrEST Antigen CD68 (APrEST85088)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch
  1. Home
  2. Products
  3. Primary Antibodies
  4. PrecisA Monoclonals
  5. Anti-CD68