Phone:+46-8 54 59 58 50
E-mail: contact@atlasantibodies.com
www.atlasantibodies.com
|
|
Atlas Antibodies AB Phone:+46-8 54 59 58 50 E-mail: contact@atlasantibodies.com www.atlasantibodies.com |
| Product name | Anti-IFITM8P | ||||||
|---|---|---|---|---|---|---|---|
| Product number | HPA014441 | ||||||
| Lot Number | R04664 | ||||||
| Description | interferon induced transmembrane protein 8 pseudogene | ||||||
| Alternative names | |||||||
| Tested applications |
Protein Array (PA)Anti-IFITM8P shows specific reactivity against target antigen. |
||||||
| Application notes | |||||||
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MNHTFQTFFTPANSGHPRNYEMLKEEHKVAVVGAPQNPAPPMSTMIHFHSETSMP | ||||||
| Vial Size | 100 µl | ||||||
| Concentration | 0.01 mg/ml | ||||||
| Raised in | Rabbit | ||||||
| Isotype | IgG | ||||||
| Clonality | Polyclonal, mono-specific. | ||||||
| Purity | Affinity purified using the PrEST antigen as affinity ligand. | ||||||
| Species reactivity | Human (Not tested in other species). | ||||||
| Appearance | Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide. | ||||||
| Storage | For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours. | ||||||
| Handling | The antibody solution should be gently mixed before use.. | ||||||
| Shipping | Shipped at ambient temperature. | ||||||
| Price | € 275 | ||||||
| Availability | Available in stock | ||||||
