| Product name |
Anti-ACSL4 |
| Product number |
HPA005552 |
| Lot Number |
A27976
|
| Description |
acyl-CoA synthetase long-chain family member 4
|
| Alternative names |
ACS4, FACL4, LACS4, MRX63, MRX68 |
| Tested applications |
Immunohistochemistry-Paraffin Embedded Tissues (IHC)
IHC-P Anti-ACSL4
|
|
Immunoperoxidase staining of formalin-fixed, paraffin-embedded human placenta tissue showing strong cytoplasmic staining of trophoblastic cells.
Recommended conditions:
- Retrieval method: HIER pH6
- Dilution: 1:200
|
|
NOTE: Please visit the Human Protein Atlas
(www.proteinatlas.org)
for the images of the
immunohistochemical analysis of 576 human
tissue samples of normal and cancer origin as
well as 59 cells and cell lines in duplicates.
|
Western Blot (WB)
WB Anti-ACSL4
|
|
Lane 1, Marker [kDa]: 220,112,84,47,32,26,16.8 Lane 2: RT-4 Lane 3: U-251MG sp Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil
Band of predicted size in kDA (+/- 20%) with additional bands present
|
Immunoflouroscence (IF)
IF Anti-ACSL4
|
|
Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & plasma membrane.
NOTE: Please visit the Human Protein Atlas
(www.proteinatlas.org)
for the images of the
immunofluorescence analysis of three different cell lines stained with the Prestige Antibody as well as with probes, displayed as
different colors/channels, targeting specific intracellular compartments.
|
Protein Array (PA)
Anti-ACSL4 shows specific reactivity against target antigen.
|
| Application notes |
Optimal concentrations and conditions for each application should be determined by the end user. |
| Immunogen |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
MNYLEVNRRVNNFGSGLTALGLKPKNTIAIFCETRAEWMIAAQTCFKYNFPLVTLYATLGKEAVVHGLN
SEASYLITSVELLESKLKTALLDISCVKHIIYVDNKAINKAEYPEGFEIHSMQSVEELGSNPENLGIPPSRPTPSDMAIV
|
| Vial Size |
100 µl |
| Concentration |
0.14 mg/ml |
| Raised in |
Rabbit |
| Isotype |
IgG |
| Clonality |
Polyclonal, mono-specific. |
| Purity |
Affinity purified using the PrEST antigen as affinity ligand. |
| Species reactivity |
Human (Not tested in other species). |
| Appearance |
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide. |
| Storage |
For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours. |
| Handling |
The antibody solution should be gently mixed before use.. |
| Shipping |
Shipped at ambient temperature. |
| Price |
€ 275 |
| Availability |
Available in stock |