RUFY3-antibody-HPA022970
RUFY3-antibody-HPA022970
Anti-RUFY3
RUN and FYVE domain containing 3
Anti-RUFY3
HPA022970
100 µl
$429.00
Available in stock
Clonality
Polyclonal
Alternative names
KIAA0871, RIPx, Singar1
Species reactivity
Human, Mouse, Rat
Recommended applications
-
Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry in Human Material
Recommended conditions:
-
Dilution: 1:50 - 1:200
-
Retrieval method: HIER pH6
Additional IHC Characterization Data
Access additional IHC-data for Anti-RUFY3 on the Human Protein Atlas. View manually annotated IHC-data from 576 human tissue samples of normal and cancer origin as well as duplicate samples from 59 clinical cell samples and cell lines.
-
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil -
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Western Blot in Human Material
Recommended conditions:
-
Dilution: 1:100 - 1:250
Additional WB Characterization Data
Access the Western Blot validation data for Anti-RUFY3 on the Human Protein Atlas. Use the Antigen View to display the antigen location on the target protein for all splice variants.
Western Blot in Rodent Material
Recommended conditions:
-
Dilution: 1:100 - 1:500
-
Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
Immunofluorescence in Human Material
Recommended conditions:
-
Fixation/Permeabilization: PFA/Triton X-100
-
Working concentration: 1-4 µg/ml
Additional IF Characterization Data
Access additional IF characterization data for Anti-RUFY3 on the Human Protein Atlas. View manually annotated subcellular localization data in three cell lines selected based on RNA sequencing data.
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Database Links
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
MLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVKQKSELNSR
LEEKTNQMAATIKQLEQRLRQAERSRQSAELDNRLFKQDFGDKINSLQLE
VEELTRQRNQLEL
LEEKTNQMAATIKQLEQRLRQAERSRQSAELDNRLFKQDFGDKINSLQLE
VEELTRQRNQLEL
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Specificity
Specific reactivity against target PrEST antigen validated on protein array with 384 randomly selected antigens.
Interspecies Information Highest antigen sequence identity to the following orthologos:
Form
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Vial Size 100 µl
Current Lot
R09354
Concentration
0.2 mg/ml
Storage Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Shipping
Normally shipped at ambient temperature
Notes
The antibody solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
We are an experienced team of researchers dedicated to helping you with any questions you have regarding our products and their applications.
100 researchers are working within the Human Protein Atlas project. Our Scientific Support Team provides you with answers or guide you to the right people
If you have questions or comments regarding this antibody please contact our Scientific Support: contact@atlasantibodies.com.
Are you using our antibodies in an application or in a species we have not yet validated? Go to our Technical Support and Resources page and read about our Explorer Program.
Related Questions
We have not received any questions yet for this product