FOXP1-antibody-HPA003876
FOXP1-antibody-HPA003876
Anti-FOXP1
-
Dilution: 1:50 - 1:200
-
Retrieval method: HIER pH6
-
Dilution: -
-
Fixation/Permeabilization: PFA/Triton X-100
-
Working concentration: 1-4 µg/ml
SAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPHASTNGQLSVHTP
KRESLSHEEHPHSHPLYGHGVCKWPGCEAVCEDFQSFLKHLNS
We are an experienced team of researchers dedicated to helping you with any questions you have regarding our products and their applications.
100 researchers are working within the Human Protein Atlas project. Our Scientific Support Team provides you with answers or guide you to the right people
If you have questions or comments regarding this antibody please contact our Scientific Support: contact@atlasantibodies.com.
Are you using our antibodies in an application or in a species we have not yet validated? Go to our Technical Support and Resources page and read about our Explorer Program.
Related Questions
We have not received any questions yet for this product






