CSNK1G1-antibody-HPA018209

CSNK1G1-antibody-HPA018209

Anti-CSNK1G1

casein kinase 1, gamma 1
Anti-CSNK1G1
HPA018209
100 µl
$429.00
Available in stock
Clonality
Polyclonal
Alternative names
CK1gamma1
Species reactivity
Human
  • Immunohistochemical staining of human gall bladder shows a distinct luminal membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry in Human Material
Recommended conditions:
  • Dilution: 1:20 - 1:50
  • Retrieval method: HIER pH6
Additional IHC Characterization Data
Access additional IHC-data for Anti-CSNK1G1 on the Human Protein Atlas. View manually annotated IHC-data from 576 human tissue samples of normal and cancer origin as well as duplicate samples from 59 clinical cell samples and cell lines.
  • Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunofluorescence in Human Material
Recommended conditions:
  • Fixation/Permeabilization: PFA/Triton X-100
  • Working concentration: 1-4 µg/ml
Additional IF Characterization Data
Access additional IF characterization data for Anti-CSNK1G1 on the Human Protein Atlas. View manually annotated subcellular localization data in three cell lines selected based on RNA sequencing data.
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TYLRYVRRLDFFEKPDYEYLRTLFTDLFEKKGYTFDYAYDWVGRPIPTPV
GSVHVDSGASAITRESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGAH
SNAPITAHAEVEVVEEAKCCCFFKRKRKKTA
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Specificity
Specific reactivity against target PrEST antigen validated on protein array with 384 randomly selected antigens.
Interspecies Information Highest antigen sequence identity to the following orthologos:
Form
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Vial Size 100 µl
Current Lot
R07094
Concentration
0.1 mg/ml
Storage Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Shipping
Normally shipped at ambient temperature
Notes
The antibody solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Human Protein Atlas

This antibody has been used for staining of 48 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

We are an experienced team of researchers dedicated to helping you with any questions you have regarding our products and their applications.

100 researchers are working within the Human Protein Atlas project. Our Scientific Support Team provides you with answers or guide you to the right people

If you have questions or comments regarding this antibody please contact our Scientific Support: contact@atlasantibodies.com.

Are you using our antibodies in an application or in a species we have not yet validated? Go to our Technical Support and Resources page and read about our Explorer Program.

Related Questions

We have not received any questions yet for this product

Forgot your email?