CDC42EP4-antibody-HPA024797

CDC42EP4-antibody-HPA024797

Anti-CDC42EP4

CDC42 effector protein (Rho GTPase binding) 4
Anti-CDC42EP4
HPA024797
100 µl
$429.00
Available in stock
Clonality
Polyclonal
Alternative names
BORG4, CEP4, KAIA1777, MGC17125, MGC3740
Species reactivity
Human
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
Immunohistochemistry in Human Material
Recommended conditions:
  • Dilution: 1:20 - 1:50
  • Retrieval method: HIER pH6
Additional IHC Characterization Data
Access additional IHC-data for Anti-CDC42EP4 on the Human Protein Atlas. View manually annotated IHC-data from 576 human tissue samples of normal and cancer origin as well as duplicate samples from 59 clinical cell samples and cell lines.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
    Lane 2: Negative control (vector only transfected HEK293T lysate)
    Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415972)
Western Blot in Human Material
Recommended conditions:
  • Dilution: 1:100 - 1:250
Additional WB Characterization Data
Access the Western Blot validation data for Anti-CDC42EP4 on the Human Protein Atlas. Use the Antigen View to display the antigen location on the target protein for all splice variants.
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PVKKANDGEGGDEEAGTEEAVPRRNGAAGPHSPDPLLDEQAFGDLTDLPV
VPKATYGLKHAESIMSFHIDLGPSMLGDVLSIMDKEEWDPEEGEGGYHGD
EGA
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Specificity
Specific reactivity against target PrEST antigen validated on protein array with 384 randomly selected antigens.
Interspecies Information Highest antigen sequence identity to the following orthologos:
Form
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Vial Size 100 µl
Current Lot
R26649
Concentration
0.05 mg/ml
Storage Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Shipping
Normally shipped at ambient temperature
Notes
The antibody solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Human Protein Atlas

This antibody has been used for staining of 46 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibody-based proteomics.

We are an experienced team of researchers dedicated to helping you with any questions you have regarding our products and their applications.

100 researchers are working within the Human Protein Atlas project. Our Scientific Support Team provides you with answers or guide you to the right people

If you have questions or comments regarding this antibody please contact our Scientific Support: contact@atlasantibodies.com.

Are you using our antibodies in an application or in a species we have not yet validated? Go to our Technical Support and Resources page and read about our Explorer Program.

Related Questions

We have not received any questions yet for this product

Forgot your email?