Product Catalogue for European Customers

Non-European customers, please go to Sigma Prestige Antibodies to order your Prestige Antibodies®

ANTI-ABRA

Product name ANTI-ABRA
Product number HPA017724
Lot Number R07222
Description Actin-binding Rho-activating protein (Striated muscle activator of Rho-dependent signaling)(STARS)
Database links Ensembl: ENSG00000174429
Uniprot/SWISSPROT;Acc:Q8N0Z2
Alternative names STARS
Tested Applications

Immunohistochemistry-Paraffin Embedded Tissues (IHC-P)

IHC-P ANTI-ABRA

Hpa017724_t
Magnify Click the image to magnify

Immunohistochemical staining of human skeletal muscle showed strong cytoplasmic positivity.

Recommended conditions:

  • Retrieval method: HIER pH6
  • Dilution: 1:125

Link to HPA image gallery

NOTE: Please visit the Human Protein Atlas (www.proteinatlas.org) for the images of the immunohistochemical analysis of 576 human tissue samples of normal and cancer origin as well as 59 cells and cell lines in duplicates.

Western Blot (WB)

WB ANTI-ABRA

HPA017724

Lane 1, Marker [kDa]: 230,130,95,72,56,36,28,17,11
Lane 2, RT-4
Lane 3, U-251MG sp
Lane 4, Human Plasma
Lane 5, Liver
Lane 6, Tonsil

Band of predicted size in kDA (+/- 20%)
with additional bands present


Protein Array (PA)

ANTI-ABRA shows specific reactivity against target antigen.

Application notes Protocols
Optimal concentrations and conditions for each application should be determined by the end user.
Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

AKSALRKIRTATLVISLARGWQQWANENSIRQAQEPTGWLPGGTQDSPQA
PKPITPPTSHQKAQSAPKSPPRLPEGHGDGQSSEKAPEVSHIKKKEVSKT
VVSKTYERGGDVSHLSHRYERDAGVLEPGQ

Vial Size 100 µl
Concentration 0.38 mg/ml
Raised in Rabbit
Isotype IgG
Clonality Polyclonal, mono-specific.
Purity Affinity purified using the PrEST antigen as affinity ligand.
Species reactivity Human (Not tested in other species).
Appearance Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide.
Material Safety Data Sheet
Storage For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
Handling The antibody solution should be gently mixed before use.
Shipping Shipped at ambient temperature.
Price € 275  Freight costs
Availability Available in stock