Add-to-cart Printer friendly view

Anti-ABRA


Product name Anti-ABRA
Product number HPA017724
Lot Number R07222
Description actin-binding Rho activating protein
Database links Human Protein Atlas: ENSG00000174429
Ensembl: ENSG00000174429
Uniprot/SWISSPROT;Acc:Q8N0Z2
HGNC Symbol;Acc:30655
Alternative names STARS
Tested Applications

Immunohistochemistry-Paraffin Embedded Tissues (IHC-P)

IHC-P Anti-ABRA
Hpa017724_t
Magnify Click the image to magnify

Immunohistochemical staining of human skeletal muscle showed strong cytoplasmic positivity.

Recommended conditions:

  • Retrieval method: HIER pH6
  • Dilution: 1:50 - 1:200

Protocol IHC-P

Optimal concentrations and conditions should be determined by the end user.

Link to all IHC characterization data on the Human Protein Atlas

NOTE: Please visit the Human Protein Atlas for the images of the immunohistochemical analysis of 576 human tissue samples of normal and cancer origin as well as 59 cells and cell lines in duplicates.

Western Blot (WB)

WB Anti-ABRA
HPA017724

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil

Recommended conditions:

  • Dilution: 1:250 - 1:500

Protocol WB

Optimal concentrations and conditions should be determined by the end user.

Link to WB characterization data on the Human Protein Atlas

Protein Array (PA)

Anti-ABRA shows specific reactivity against target antigen.

Protocol PA

Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

AKSALRKIRTATLVISLARGWQQWANENSIRQAQEPTGWLPGGTQDSPQA
PKPITPPTSHQKAQSAPKSPPRLPEGHGDGQSSEKAPEVSHIKKKEVSKT
VVSKTYERGGDVSHLSHRYERDAGVLEPGQ
Vial Size 100 µl
Concentration 0.4 mg/ml
Raised in Rabbit
Isotype IgG
Clonality Polyclonal, mono-specific.
Purity Affinity purified using the PrEST antigen as affinity ligand.
Species reactivity Human (Not tested in other species).
Interspecies information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000042895 (66%)
Rat ENSRNOG00000007999 (66%)
Appearance Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide.
Material Safety Data Sheet
Storage For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
Handling The antibody solution should be gently mixed before use.
Shipping Shipped at ambient temperature.
Price €315  Freight costs
Availability Available in stock