Anti-ACPL2


Product name Anti-ACPL2
Product number HPA017243
Lot Number R06780
Description acid phosphatase-like 2
Database links Human Protein Atlas: ENSG00000155893
Ensembl: ENSG00000155893
Uniprot/SWISSPROT;Acc:Q8TE99
HGNC Symbol;Acc:26303
Alternative names FLJ23751
Tested Applications

Immunohistochemistry-Paraffin Embedded Tissues (IHC-P)

IHC-P Anti-ACPL2

Hpa017243_t
Magnify Click the image to magnify

Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Recommended conditions:

  • Retrieval method: HIER pH6
  • Dilution: 1:10 - 1:20

Protocol IHC-P

Optimal concentrations and conditions should be determined by the end user.

Link to all IHC characterization data on the Human Protein Atlas

NOTE: Please visit the Human Protein Atlas for the images of the immunohistochemical analysis of 576 human tissue samples of normal and cancer origin as well as 59 cells and cell lines in duplicates.

Western Blot (WB)

WB Anti-ACPL2

HPA017243

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403459)

Recommended conditions:

  • Dilution: 1:250 - 1:500

Protocol WB

Optimal concentrations and conditions should be determined by the end user.

Link to WB characterization data on the Human Protein Atlas


Protein Array (PA)

Anti-ACPL2 shows specific reactivity against target antigen.

Protocol PA

Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

STPKNGMSSKSRKRIMPDPVTEPPVTDPVYEALLYCNIPSVAERSMEGHA
PHHFKLVSVHVFIRHGDRYPLYVIPKTKRPEIDCTLVANRKPYHPKLEAF
ISHMSKGSGASFESPLNSLPLYPNHP

Vial Size 100 µl
Concentration 0.05 mg/ml
Raised in Rabbit
Isotype IgG
Clonality Polyclonal, mono-specific.
Purity Affinity purified using the PrEST antigen as affinity ligand.
Species reactivity Human (Not tested in other species).
Interspecies information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000043587 (92%)
Rat ENSRNOG00000012480 (90%)
Appearance Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide.
Material Safety Data Sheet
Storage For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
Handling The antibody solution should be gently mixed before use.
Shipping Shipped at ambient temperature.
Price €315  Freight costs
Availability Available in stock