Product Catalogue for European Customers

Non-European customers, please go to Sigma Prestige Antibodies to order your Prestige Antibodies®

ANTI-PLBD2

Product name ANTI-PLBD2
Product number HPA017163
Lot Number R06544
Description Putative phospholipase B-like 2 Precursor (EC 3.1.1.-)(Lamina ancestor homolog 2)(LAMA-like protein 2)(76 kDa protein)(p76) [Contains Putative phospholipase B-like 2 32 kDa form;Putative phospholipase B-like 2 45 kDa form]
Database links Ensembl: ENSG00000151176
Uniprot/SWISSPROT;Acc:Q8NHP8
Alternative names p76
Tested Applications

Immunohistochemistry-Paraffin Embedded Tissues (IHC-P)

IHC-P ANTI-PLBD2

Hpa017163_t
Magnify Click the image to magnify

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Recommended conditions:

  • Retrieval method: HIER pH6
  • Dilution: 1:300

Link to all characterization data on the Human Protein Atlas

NOTE: Please visit the Human Protein Atlas (www.proteinatlas.org) for the images of the immunohistochemical analysis of 576 human tissue samples of normal and cancer origin as well as 59 cells and cell lines in duplicates.

Protein Array (PA)

ANTI-PLBD2 shows specific reactivity against target antigen.

Application notes Protocols
Optimal concentrations and conditions for each application should be determined by the end user.
Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYNDFLHDPLSLCKACNP
QPNGENAISARSDLNPANGSYPFQALRQRSHGGIDVKVTSMSLARILSLL
AASGPTWDQVPPFQWSTS

Vial Size 100 µl
Concentration 0.34 mg/ml
Raised in Rabbit
Isotype IgG
Clonality Polyclonal, mono-specific.
Purity Affinity purified using the PrEST antigen as affinity ligand.
Species reactivity Human (Not tested in other species).
Appearance Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide.
Material Safety Data Sheet
Storage For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
Handling The antibody solution should be gently mixed before use.
Shipping Shipped at ambient temperature.
Price € 275  Freight costs
Availability Available in stock