Product Catalogue for European Customers

Non-European customers, please go to Sigma Prestige Antibodies to order your Prestige Antibodies®

ANTI-ACP1

Product name ANTI-ACP1
Product number HPA016754
Lot Number R06272
Description Low molecular weight phosphotyrosine protein phosphatase (LMW-PTPase)(LMW-PTP)(EC 3.1.3.48)(Low molecular weight cytosolic acid phosphatase)(EC 3.1.3.2)(Red cell acid phosphatase 1)(Adipocyte acid phosphatase)
Database links Ensembl: ENSG00000143727
Uniprot/SWISSPROT;Acc:P24666
Tested Applications

Immunohistochemistry-Paraffin Embedded Tissues (IHC-P)

IHC-P ANTI-ACP1

Hpa016754_t
Magnify Click the image to magnify

Immunohistochemical staining of human testis shows cytoplasmic positivity of cells in seminiferus ducts.

Recommended conditions:

  • Retrieval method: HIER pH6
  • Dilution: 1:200

Link to all characterization data on the Human Protein Atlas

NOTE: Please visit the Human Protein Atlas (www.proteinatlas.org) for the images of the immunohistochemical analysis of 576 human tissue samples of normal and cancer origin as well as 59 cells and cell lines in duplicates.

Western Blot (WB)

WB ANTI-ACP1

HPA016754

Lane 1, Marker [kDa]: 230,130,95,72,56,36,28,17,11
Lane 2, RT-4
Lane 3, U-251MG sp
Lane 4, Human Plasma
Lane 5, Liver
Lane 6, Tonsil

Single band corresponding to the predicted
size in kDa (+/- 20%)

Link to all characterization data on the Human Protein Atlas


Protein Array (PA)

ANTI-ACP1 shows specific reactivity against target antigen.

Application notes Protocols
Optimal concentrations and conditions for each application should be determined by the end user.
Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFD
YILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDS
DFETVYQ

Vial Size 100 µl
Concentration 0.13 mg/ml
Raised in Rabbit
Isotype IgG
Clonality Polyclonal, mono-specific.
Purity Affinity purified using the PrEST antigen as affinity ligand.
Species reactivity Human (Not tested in other species).
Appearance Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide.
Material Safety Data Sheet
Storage For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
Handling The antibody solution should be gently mixed before use.
Shipping Shipped at ambient temperature.
Price € 275  Freight costs
Availability Available in stock