Product Catalogue for European Customers

Non-European customers, please go to Sigma Prestige Antibodies to order your Prestige Antibodies®

ANTI-AC008537.5

Product name ANTI-AC008537.5
Product number HPA016715
Lot Number R06639
Description Putative cytochrome P450 2G1-like protein
Database links Ensembl: ENSG00000130612
Uniprot/SWISSPROT;Acc:Q6ZSU1
Tested Applications

Immunohistochemistry-Paraffin Embedded Tissues (IHC-P)

IHC-P ANTI-AC008537.5

Hpa016715_t
Magnify Click the image to magnify

Immunohistochemical staining of human duodenum shows granular cytoplasmic positivity in glandular cells.

Recommended conditions:

  • Retrieval method: HIER pH6
  • Dilution: 1:350

Link to HPA image gallery

NOTE: Please visit the Human Protein Atlas (www.proteinatlas.org) for the images of the immunohistochemical analysis of 576 human tissue samples of normal and cancer origin as well as 59 cells and cell lines in duplicates.

Protein Array (PA)

ANTI-AC008537.5 shows specific reactivity against target antigen.

Application notes Protocols
Optimal concentrations and conditions for each application should be determined by the end user.
Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

DVVIHEIQRLVDIVPMGVPHNIIQDTQFRGYLLPKGTDVFPLLGSVLKDP
KYFRYPDAFYPQHFLDEQGRFKKNEAFVPFSSGKRICLGEAMARMELFLY
FTSTLQNFSLCSLVPLVDIDITPKLSGFGNITPTYE

Vial Size 100 µl
Concentration 0.27 mg/ml
Raised in Rabbit
Isotype IgG
Clonality Polyclonal, mono-specific.
Purity Affinity purified using the PrEST antigen as affinity ligand.
Species reactivity Human (Not tested in other species).
Appearance Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide.
Material Safety Data Sheet
Storage For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
Handling The antibody solution should be gently mixed before use.
Shipping Shipped at ambient temperature.
Price € 275  Freight costs
Availability Available in stock