Product Catalogue for European Customers

Non-European customers, please go to Sigma Prestige Antibodies to order your Prestige Antibodies®

Add-to-cart Printer friendly view

ANTI-IFITM8P

Product name ANTI-IFITM8P
Product number HPA014441
Lot Number R04664
Description Putative uncharacterized protein IFITM8P
Database links Ensembl: ENSG00000215096
Uniprot/SWISSPROT;Acc:A8MWN3
Tested Applications

Immunohistochemistry-Paraffin Embedded Tissues (IHC-P)

IHC-P ANTI-IFITM8P
Hpa014441_t
Magnify Click the image to magnify

Immunohistochemical staining of human epididymis shows strong positivity in cilia and membranes of glandular cells.

Recommended conditions:

  • Retrieval method: HIER pH6
  • Dilution: 1:15

Link to all characterization data on the Human Protein Atlas

NOTE: Please visit the Human Protein Atlas (www.proteinatlas.org) for the images of the immunohistochemical analysis of 576 human tissue samples of normal and cancer origin as well as 59 cells and cell lines in duplicates.

Protein Array (PA)

ANTI-IFITM8P shows specific reactivity against target antigen.

Application notes Protocols
Optimal concentrations and conditions for each application should be determined by the end user.
Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MNHTFQTFFTPANSGHPRNYEMLKEEHKVAVVGAPQNPAPPMSTMIHFHS
ETSMP
Vial Size 100 µl
Concentration 0.01 mg/ml
Raised in Rabbit
Isotype IgG
Clonality Polyclonal, mono-specific.
Purity Affinity purified using the PrEST antigen as affinity ligand.
Species reactivity Human (Not tested in other species).
Appearance Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide.
Material Safety Data Sheet
Storage For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
Handling The antibody solution should be gently mixed before use.
Shipping Shipped at ambient temperature.
Price € 275  Freight costs
Availability Available in stock