Add-to-cart Printer friendly view

Anti-ACSL1


Product name Anti-ACSL1
Product number HPA011964
Lot Number R03780
Description acyl-CoA synthetase long-chain family member 1
Database links Human Protein Atlas: ENSG00000151726
Ensembl: ENSG00000151726
Uniprot/SWISSPROT;Acc:P33121
HGNC Symbol;Acc:3569
Alternative names ACS1, FACL1, FACL2, LACS, LACS1, LACS2
Tested Applications

Immunohistochemistry-Paraffin Embedded Tissues (IHC-P)

IHC-P Anti-ACSL1
Hpa011964_t
Magnify Click the image to magnify

Immunohistochemical staining of human liver shows strong cytoplasmic positivity in granular pattern in hepatocytes.

Recommended conditions:

  • Retrieval method: HIER pH6
  • Dilution: 1:200 - 1:500

Protocol IHC-P

Optimal concentrations and conditions should be determined by the end user.

Link to all IHC characterization data on the Human Protein Atlas

NOTE: Please visit the Human Protein Atlas for the images of the immunohistochemical analysis of 576 human tissue samples of normal and cancer origin as well as 59 cells and cell lines in duplicates.

Western Blot (WB)

WB Anti-ACSL1
HPA011964

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil

Recommended conditions:

  • Dilution: 1:250 - 1:500

Protocol WB

Optimal concentrations and conditions should be determined by the end user.

Link to WB characterization data on the Human Protein Atlas

Protein Array (PA)

Anti-ACSL1 shows specific reactivity against target antigen.

Protocol PA

Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

IIEQGCFAYSMVIVPLYDTLGNEAITYIVNKAELSLVFVDKPEKAKLLLE
GVENKLIPGLKIIVVMDAYGSELVERGQRCGVEVTSMKAMEDLGRANRRK
PKPPAPEDLAVICFTSGTTGNPKGAMVTHRN
Vial Size 100 µl
Concentration 0.1 mg/ml
Raised in Rabbit
Isotype IgG
Clonality Polyclonal, mono-specific.
Purity Affinity purified using the PrEST antigen as affinity ligand.
Species reactivity Human (Not tested in other species).
Interspecies information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000018796 (81%)
Rat ENSRNOG00000010633 (80%)
Appearance Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide.
Material Safety Data Sheet
Storage For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
Handling The antibody solution should be gently mixed before use.
Shipping Shipped at ambient temperature.
Price €315  Freight costs
Availability Available in stock