Product Catalogue for European Customers

Non-European customers, please go to Sigma Prestige Antibodies to order your Prestige Antibodies®

Add-to-cart Printer friendly view

ANTI-RPL10

Product name ANTI-RPL10
Product number HPA011311
Lot Number R03130
Description 60S ribosomal protein L10 (Protein QM)(Tumor suppressor QM)(Laminin receptor homolog)
Database links Ensembl: ENSG00000147403
Uniprot/SWISSPROT;Acc:P27635
Alternative names DXS648, DXS648E, FLJ23544, NOV, QM
Tested Applications

Immunohistochemistry-Paraffin Embedded Tissues (IHC-P)

IHC-P ANTI-RPL10
Hpa011311_t
Magnify Click the image to magnify

Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.

Recommended conditions:

  • Retrieval method: HIER pH6
  • Dilution: 1:35

Link to HPA image gallery

NOTE: Please visit the Human Protein Atlas (www.proteinatlas.org) for the images of the immunohistochemical analysis of 576 human tissue samples of normal and cancer origin as well as 59 cells and cell lines in duplicates.

Western Blot (WB)

WB ANTI-RPL10
HPA011311

Lane 1, Marker [kDa]: 230,130,95,72,56,36,28,17,11
Lane 2, RT-4
Lane 3, U-251MG sp
Lane 4, Human Plasma
Lane 5, Liver
Lane 6, Tonsil

Band of predicted size in kDA (+/- 20%)
with additional bands present

Immunoflouroscence (IF)

IF ANTI-RPL10
Hpa011311_t
Magnify Click the image to magnify

Immunofluorescent staining of human cell line U-251MG shows positivity in cytoplasm.

NOTE: Please visit the Human Protein Atlas (www.proteinatlas.org) for the images of the immunofluorescence analysis of three different cell lines stained with the Prestige Antibody as well as with probes, displayed as different colors/channels, targeting specific intracellular compartments.

Link to HPA image gallery

Protein Array (PA)

ANTI-RPL10 shows specific reactivity against target antigen.

Application notes Protocols
Optimal concentrations and conditions for each application should be determined by the end user.
Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KMSSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIE
ALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYI
PSRGPLDKWW

Vial Size 100 µl
Concentration 0.04 mg/ml
Raised in Rabbit
Isotype IgG
Clonality Polyclonal, mono-specific.
Purity Affinity purified using the PrEST antigen as affinity ligand.
Species reactivity Human (Not tested in other species).
Appearance Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide.
Material Safety Data Sheet
Storage For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
Handling The antibody solution should be gently mixed before use.
Shipping Shipped at ambient temperature.
Price € 275  Freight costs
Availability Available in stock