Add-to-cart Printer friendly view

Anti-CDHR3


Product name Anti-CDHR3
Product number HPA011218
Lot Number R03271
Description cadherin-related family member 3
Database links Human Protein Atlas: ENSG00000128536
Ensembl: ENSG00000128536
Uniprot/SWISSPROT;Acc:Q6ZTQ4
HGNC Symbol;Acc:26308
Alternative names CDH28, FLJ23834, FLJ44366
Tested Applications

Immunohistochemistry-Paraffin Embedded Tissues (IHC-P)

IHC-P Anti-CDHR3
Hpa011218_t
Magnify Click the image to magnify

Immunohistochemical staining of human duodenum shows distinct cytoplasmic positivity in glandular cells.

Recommended conditions:

  • Retrieval method: HIER pH6
  • Dilution: 1:10 - 1:20

Protocol IHC-P

Optimal concentrations and conditions should be determined by the end user.

Link to all IHC characterization data on the Human Protein Atlas

NOTE: Please visit the Human Protein Atlas for the images of the immunohistochemical analysis of 576 human tissue samples of normal and cancer origin as well as 59 cells and cell lines in duplicates.

Protein Array (PA)

Anti-CDHR3 shows specific reactivity against target antigen.

Protocol PA

Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWEEDELSGKAWAEDAGL
GSRNEGGKLGNPKNRNPAFMNRAYPKPHPGK
Vial Size 100 µl
Concentration 0.05 mg/ml
Raised in Rabbit
Isotype IgG
Clonality Polyclonal, mono-specific.
Purity Affinity purified using the PrEST antigen as affinity ligand.
Species reactivity Human (Not tested in other species).
Interspecies information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000025064 (27%)
ENSMUSG00000037703 (27%)
ENSMUSG00000047810 (27%)
Rat ENSRNOG00000009872 (27%)
ENSRNOG00000012110 (27%)
Appearance Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide.
Material Safety Data Sheet
Storage For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
Handling The antibody solution should be gently mixed before use.
Shipping Shipped at ambient temperature.
Price €315  Freight costs
Availability Available in stock