Online Store for European Customers

Non-European customers, please go to Sigma Prestige Antibodies to order your Prestige AntibodiesTM

Add-to-cart Printer friendly view

Anti-AC004836.2

Product name Anti-AC004836.2
Product number HPA011218
Lot Number R03271
Description Cadherin-like protein 28 precursor.
Database links Ensembl: ENSG00000128536
Uniprot/SWISSPROT;Acc:Q6ZTQ4
Tested Applications

Immunohistochemistry-Paraffin Embedded Tissues (IHC-P)

IHC-P Anti-AC004836.2
Hpa011218_t
Magnify Click the image to magnify

Immunoperoxidase staining of formalin-fixed, paraffin-embedded human placental tissue showing cytoplasmic and/or membranous positivity in trophoblastic cells.

Recommended conditions:

  • Retrieval method: HIER pH6
  • Dilution: 1:10

Link to HPA image gallery

NOTE: Please visit the Human Protein Atlas (www.proteinatlas.org) for the images of the immunohistochemical analysis of 576 human tissue samples of normal and cancer origin as well as 59 cells and cell lines in duplicates.

Protein Array (PA)

Anti-AC004836.2 shows specific reactivity against target antigen.

Application notes Protocols
Optimal concentrations and conditions for each application should be determined by the end user.
Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWEEDELSGKAWAEDAGL
GSRNEGGKLGNPKNRNPAFMNRAYPKPHPGK
Vial Size 100 µl
Concentration 0.06 mg/ml
Raised in Rabbit
Isotype IgG
Clonality Polyclonal, mono-specific.
Purity Affinity purified using the PrEST antigen as affinity ligand.
Species reactivity Human (Not tested in other species).
Appearance Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide.
Material Safety Data Sheet
Storage For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
Handling The antibody solution should be gently mixed before use.
Shipping Shipped at ambient temperature.
Price € 275  Freight costs
Availability Available in stock