Add-to-cart Printer friendly view

Anti-ACSF3


Product name Anti-ACSF3
Product number HPA008323
Lot Number R02641
Description acyl-CoA synthetase family member 3
Database links Human Protein Atlas: ENSG00000176715
Ensembl: ENSG00000176715
Uniprot/SWISSPROT;Acc:Q4G176
HGNC Symbol;Acc:27288
Tested Applications

Immunohistochemistry-Paraffin Embedded Tissues (IHC-P)

IHC-P Anti-ACSF3
Hpa008323_t
Magnify Click the image to magnify

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Recommended conditions:

  • Retrieval method: HIER pH6
  • Dilution: 1:20 - 1:50

Protocol IHC-P

Optimal concentrations and conditions should be determined by the end user.

Link to all IHC characterization data on the Human Protein Atlas

NOTE: Please visit the Human Protein Atlas for the images of the immunohistochemical analysis of 576 human tissue samples of normal and cancer origin as well as 59 cells and cell lines in duplicates.

Protein Array (PA)

Anti-ACSF3 shows specific reactivity against target antigen.

Protocol PA

Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VARSDRSAPVFTRALAFGDRIALVDQHGRHTYRELYSRSLRLSQEICRLC
GCVGGDLREERVSFLCANDASYVVAQWASWMSGGVAVPLYRKHPAAQLEY
VICDSQSSVVLASQEYLELLSPVVRKLGVPLLPLTPAIYTGAVEEPAE
Vial Size 100 µl
Concentration 0.1 mg/ml
Raised in Rabbit
Isotype IgG
Clonality Polyclonal, mono-specific.
Purity Affinity purified using the PrEST antigen as affinity ligand.
Species reactivity Human (Not tested in other species).
Interspecies information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000015016 (74%)
Rat ENSRNOG00000015077 (76%)
Appearance Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide.
Material Safety Data Sheet
Storage For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
Handling The antibody solution should be gently mixed before use.
Shipping Shipped at ambient temperature.
Price €315  Freight costs
Availability Available in stock