Product Catalogue for European Customers

Non-European customers, please go to Sigma Prestige Antibodies to order your Prestige Antibodies®

ANTI-ACSF3

Product name ANTI-ACSF3
Product number HPA008322
Lot Number R01658
Description Acyl-CoA synthetase family member 3, mitochondrial Precursor (EC 6.2.1.-)
Database links Ensembl: ENSG00000176715
Uniprot/SWISSPROT;Acc:Q4G176
Tested Applications

Immunohistochemistry-Paraffin Embedded Tissues (IHC-P)

IHC-P ANTI-ACSF3

Hpa008322_t
Magnify Click the image to magnify

Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Recommended conditions:

  • Retrieval method: HIER pH6
  • Dilution: 1:100

Link to all characterization data on the Human Protein Atlas

NOTE: Please visit the Human Protein Atlas (www.proteinatlas.org) for the images of the immunohistochemical analysis of 576 human tissue samples of normal and cancer origin as well as 59 cells and cell lines in duplicates.

Western Blot (WB)

WB ANTI-ACSF3

HPA008322

Lane 1, Marker [kDa]: 230,130,95,72,56,36,28,17,11
Lane 2, RT-4
Lane 3, U-251MG sp
Lane 4, Human Plasma
Lane 5, Liver
Lane 6, Tonsil

Band of predicted size in kDA (+/- 20%)
with additional bands present

Link to all characterization data on the Human Protein Atlas


Protein Array (PA)

ANTI-ACSF3 shows specific reactivity against target antigen.

Application notes Protocols
Optimal concentrations and conditions for each application should be determined by the end user.
Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ATCVMMPEFSPQQVWEKFLSSETPRINVFMAVPTIYTKLMEYYDRHFTQP
HAQDFLRAVCEEKIRLMVSGSAALPLPVLEKWKNITGHTLLERYGMTEIG
MALSGPLTTAVRLPGSVGTPLPGVQVRIVSENPQREACSYTIHA

Vial Size 100 µl
Concentration 0.15 mg/ml
Raised in Rabbit
Isotype IgG
Clonality Polyclonal, mono-specific.
Purity Affinity purified using the PrEST antigen as affinity ligand.
Species reactivity Human (Not tested in other species).
Appearance Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide.
Material Safety Data Sheet
Storage For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
Handling The antibody solution should be gently mixed before use.
Shipping Shipped at ambient temperature.
Price € 275  Freight costs
Availability Available in stock