Product Catalogue for European Customers

Non-European customers, please go to Sigma Prestige Antibodies to order your Prestige Antibodies®

ANTI-ACSL4

Product name ANTI-ACSL4
Product number HPA005552
Lot Number R04197
Description Long-chain-fatty-acid--CoA ligase 4 (EC 6.2.1.3)(Long-chain acyl-CoA synthetase 4)(LACS 4)
Database links Ensembl: ENSG00000068366
Uniprot/SWISSPROT;Acc:O60488
Alternative names ACS4, FACL4, LACS4, MRX63, MRX68
Tested Applications

Immunohistochemistry-Paraffin Embedded Tissues (IHC-P)

IHC-P ANTI-ACSL4

Hpa005552_t
Magnify Click the image to magnify

Immunoperoxidase staining of formalin-fixed, paraffin-embedded human placenta tissue showing strong cytoplasmic staining of trophoblastic cells.

Recommended conditions:

  • Retrieval method: HIER pH6
  • Dilution: 1:100

Link to all characterization data on the Human Protein Atlas

NOTE: Please visit the Human Protein Atlas (www.proteinatlas.org) for the images of the immunohistochemical analysis of 576 human tissue samples of normal and cancer origin as well as 59 cells and cell lines in duplicates.

Western Blot (WB)

WB ANTI-ACSL4

HPA005552

Lane 1, Marker [kDa]: 220,112,84,47,32,26,16.8
Lane 2, RT-4
Lane 3, U-251MG sp
Lane 4, Human Plasma
Lane 5, Liver
Lane 6, Tonsil

Band of predicted size in kDA (+/- 20%)
with additional bands present

Link to all characterization data on the Human Protein Atlas


Immunoflouroscence (IF)

IF ANTI-ACSL4

Hpa005552_t
Magnify Click the image to magnify

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & plasma membrane.

NOTE: Please visit the Human Protein Atlas (www.proteinatlas.org) for the images of the immunofluorescence analysis of three different cell lines stained with the Prestige Antibody as well as with probes, displayed as different colors/channels, targeting specific intracellular compartments.

Link to all characterization data on the Human Protein Atlas


Protein Array (PA)

ANTI-ACSL4 shows specific reactivity against target antigen.

Application notes Protocols
Optimal concentrations and conditions for each application should be determined by the end user.
Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MNYLEVNRRVNNFGSGLTALGLKPKNTIAIFCETRAEWMIAAQTCFKYNF
PLVTLYATLGKEAVVHGLNESEASYLITSVELLESKLKTALLDISCVKHI
IYVDNKAINKAEYPEGFEIHSMQSVEELGSNPENLGIPPSRPTPSDMAIV

Vial Size 100 µl
Concentration 0.08 mg/ml
Raised in Rabbit
Isotype IgG
Clonality Polyclonal, mono-specific.
Purity Affinity purified using the PrEST antigen as affinity ligand.
Species reactivity Human (Not tested in other species).
Appearance Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide.
Material Safety Data Sheet
Storage For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
Handling The antibody solution should be gently mixed before use.
Shipping Shipped at ambient temperature.
Price € 275  Freight costs
Availability Available in stock