Add-to-cart Printer friendly view

Anti-ACSS2


Product name Anti-ACSS2
Product number HPA004141
Lot Number A08732
Description acyl-CoA synthetase short-chain family member 2
Database links Human Protein Atlas: ENSG00000131069
Ensembl: ENSG00000131069
Uniprot/SWISSPROT;Acc:Q9NR19
HGNC Symbol;Acc:15814
Alternative names ACAS2, AceCS, ACS, ACSA, dJ1161H23.1
Tested Applications

Immunohistochemistry-Paraffin Embedded Tissues (IHC-P)

IHC-P Anti-ACSS2
Hpa004141_t
Magnify Click the image to magnify

Immunohistochemical staining of human testis shows distinct cytoplasmic and nuclear positivity in leydig cells.

Recommended conditions:

  • Retrieval method: HIER pH6
  • Dilution: 1:50 - 1:200

Protocol IHC-P

Optimal concentrations and conditions should be determined by the end user.

Link to all IHC characterization data on the Human Protein Atlas

NOTE: Please visit the Human Protein Atlas for the images of the immunohistochemical analysis of 576 human tissue samples of normal and cancer origin as well as 59 cells and cell lines in duplicates.

Western Blot (WB)

WB Anti-ACSS2
HPA004141

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil

Recommended conditions:

  • Dilution: 1:250 - 1:500

Protocol WB

Optimal concentrations and conditions should be determined by the end user.

Link to WB characterization data on the Human Protein Atlas

Immunoflouroscence (IF)

IF Anti-ACSS2
Hpa004141_t
Magnify Click the image to magnify

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli, cytoplasm & vesicles.

Antibody staining is shown in green.

Recommended conditions:

  • Fixation/Permeabilization: PFA/Triton X-100
  • Working concentration: 1-4 µg/ml

Protocol IF

Optimal concentrations and conditions should be determined by the end user.

NOTE: Please visit the Human Protein Atlas for the images of the immunofluorescence analysis of three different cell lines stained with the antibody as well as with probes, displayed as different colors/channels, targeting specific intracellular compartments.

Link to all IF characterization data on the Human Protein Atlas

Protein Array (PA)

Anti-ACSS2 shows specific reactivity against target antigen.

Protocol PA

Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

PGETTQITYHQLLVQVCQFSNVLRKQGIQKGDRVAIYMPMIPELVVAMLA
CARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKEL
ADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQ
Vial Size 100 µl
Concentration 0.1 mg/ml
Raised in Rabbit
Isotype IgG
Clonality Polyclonal, mono-specific.
Purity Affinity purified using the PrEST antigen as affinity ligand.
Species reactivity Human (Not tested in other species).
Interspecies information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000027605 (91%)
Rat ENSRNOG00000018755 (90%)
Appearance Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide.
Material Safety Data Sheet
Storage For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
Handling The antibody solution should be gently mixed before use.
Shipping Shipped at ambient temperature.
Price €315  Freight costs
Availability Available in stock