Anti-T


Product name Anti-T
Product number HPA003322
Lot Number A08757
Description T, brachyury homolog (mouse)
Database links Human Protein Atlas: ENSG00000164458
Ensembl: ENSG00000164458
Uniprot/SWISSPROT;Acc:O15178
HGNC Symbol;Acc:11515
Tested Applications

Immunohistochemistry-Paraffin Embedded Tissues (IHC-P)

IHC-P Anti-T

Hpa003322_t
Magnify Click the image to magnify

Immunohistochemical staining of human bone marrow shows moderate nuclear positivity in a subset of bone marrow poietic cells.

Recommended conditions:

  • Retrieval method: HIER pH6
  • Dilution: 1:20 - 1:50

Protocol IHC-P

Optimal concentrations and conditions should be determined by the end user.

Link to all IHC characterization data on the Human Protein Atlas

NOTE: Please visit the Human Protein Atlas for the images of the immunohistochemical analysis of 576 human tissue samples of normal and cancer origin as well as 59 cells and cell lines in duplicates.

Protein Array (PA)

Anti-T shows specific reactivity against target antigen.

Protocol PA

Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

QQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHR
SSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNWSSLGMPAHPSMLPVSH
NASPPTSSSQY

Vial Size 100 µl
Concentration 0.05 mg/ml
Raised in Rabbit
Isotype IgG
Clonality Polyclonal, mono-specific.
Purity Affinity purified using the PrEST antigen as affinity ligand.
Species reactivity Human (Not tested in other species).
Interspecies information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000062327 (85%)
Rat ENSRNOG00000012229 (87%)
Appearance Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide.
Material Safety Data Sheet
Storage For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
Handling The antibody solution should be gently mixed before use.
Shipping Shipped at ambient temperature.
Price €315  Freight costs
Availability Available in stock