Product Catalogue for European Customers

Non-European customers, please go to Sigma Prestige Antibodies to order your Prestige Antibodies®

Anti-WAS

Product name Anti-WAS
Product number HPA002022
Lot Number R00623
Description Wiskott-Aldrich syndrome (eczema-thrombocytopenia)
Database links Ensembl: ENSG00000015285
Uniprot/SWISSPROT;Acc:P42768
HGNC Symbol;Acc:12731
Alternative names IMD2, THC, WASP
Tested Applications

Immunohistochemistry-Paraffin Embedded Tissues (IHC-P)

IHC-P Anti-WAS

Hpa002022_t
Magnify Click the image to magnify

Immunoperoxidase staining of formalin-fixed, paraffin-embedded human lymph node tissue showing cytoplasmic and/or membranous staining of follicle (cortex) and non-follicle (paracortex) cells.

Recommended conditions:

  • Retrieval method: HIER pH6
  • Dilution: 1:500

Link to all characterization data on the Human Protein Atlas

NOTE: Please visit the Human Protein Atlas (www.proteinatlas.org) for the images of the immunohistochemical analysis of 576 human tissue samples of normal and cancer origin as well as 59 cells and cell lines in duplicates.

Protein Array (PA)

Anti-WAS shows specific reactivity against target antigen.

Application notes Protocols
Optimal concentrations and conditions for each application should be determined by the end user.
Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRA
LVQEKIQKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPLHPGGDQGGPP
VGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKK

Vial Size 100 µl
Concentration 0.34 mg/ml
Raised in Rabbit
Isotype IgG
Clonality Polyclonal, mono-specific.
Purity Affinity purified using the PrEST antigen as affinity ligand.
Species reactivity Human (Not tested in other species).
Appearance Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide.
Material Safety Data Sheet
Storage For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
Handling The antibody solution should be gently mixed before use
Shipping Shipped at ambient temperature.
Price € 275  Freight costs
Availability Available in stock