Add-to-cart Printer friendly view

Anti-ACE2


Product name Anti-ACE2
Product number HPA000288
Lot Number A57891
Description angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
Database links Human Protein Atlas: ENSG00000130234
Ensembl: ENSG00000130234
Uniprot/SWISSPROT;Acc:Q9BYF1
HGNC Symbol;Acc:13557
Tested Applications

Immunohistochemistry-Paraffin Embedded Tissues (IHC-P)

IHC-P Anti-ACE2
Hpa000288_t
Magnify Click the image to magnify

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Recommended conditions:

  • Retrieval method: HIER pH6
  • Dilution: 1:200 - 1:500

Protocol IHC-P

Optimal concentrations and conditions should be determined by the end user.

Link to all IHC characterization data on the Human Protein Atlas

NOTE: Please visit the Human Protein Atlas for the images of the immunohistochemical analysis of 576 human tissue samples of normal and cancer origin as well as 59 cells and cell lines in duplicates.

Protein Array (PA)

Anti-ACE2 shows specific reactivity against target antigen.

Protocol PA

References

Lee HJ et al
Gene expression profiling of metaplastic lineages identifies CDH17 as a prognostic marker in early stage gastric cancer.
Gastroenterology 2010 Jul;139(1):213-25.e3
PubMed ID: 20398667
DOI: 10.1053/j.gastro.2010.04.008

Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNY
NTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQAL
QQNGSSVLSED
Vial Size 100 µl
Concentration 0.1 mg/ml
Raised in Rabbit
Isotype IgG
Clonality Polyclonal, mono-specific.
Purity Affinity purified using the PrEST antigen as affinity ligand.
Species reactivity Human (Not tested in other species).
Interspecies information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000015405 (74%)
Rat ENSRNOG00000031665 (74%)
Appearance Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide.
Material Safety Data Sheet
Storage For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
Handling The antibody solution should be gently mixed before use.
Shipping Shipped at ambient temperature.
Price €315  Freight costs
Availability Available in stock