Anti-FBXO18


Product name Anti-FBXO18
Product number HPA002844
Lot Number A08937
Description F-box protein, helicase, 18
Database links Human Protein Atlas: ENSG00000134452
Ensembl: ENSG00000134452
Uniprot/SWISSPROT;Acc:Q8NFZ0
HGNC Symbol;Acc:13620
Alternative names FBH1, Fbx18, FLJ14590
Tested Applications

Immunohistochemistry-Paraffin Embedded Tissues (IHC-P)

IHC-P Anti-FBXO18

Hpa002844_t
Magnify Click the image to magnify

Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.

Recommended conditions:

  • Retrieval method: HIER pH6
  • Dilution: 1:200 - 1:500

Protocol IHC-P

Optimal concentrations and conditions should be determined by the end user.

Link to all IHC characterization data on the Human Protein Atlas

NOTE: Please visit the Human Protein Atlas for the images of the immunohistochemical analysis of 576 human tissue samples of normal and cancer origin as well as 59 cells and cell lines in duplicates.

Immunoflouroscence (IF)

IF Anti-FBXO18

Hpa002844_t
Magnify Click the image to magnify

Immunofluorescent staining of human cell line U-251MG shows positivity in nuclei.

Antibody staining is shown in green.

Recommended conditions:

  • Fixation/Permeabilization: PFA/Triton X-100
  • Working concentration: 1-4 µg/ml

Protocol IF

Optimal concentrations and conditions should be determined by the end user.

NOTE: Please visit the Human Protein Atlas for the images of the immunofluorescence analysis of three different cell lines stained with the antibody as well as with probes, displayed as different colors/channels, targeting specific intracellular compartments.

Link to all IF characterization data on the Human Protein Atlas


Protein Array (PA)

Anti-FBXO18 shows specific reactivity against target antigen.

Protocol PA

Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

HQMTHDGYLKLWQLSKPSLASFDAIFVDEAQDCTPAIMNIVLSQPCGKIF
VGDPHQQIYTFRGAVNALFTVPHTHVFYLTQSFRFGVEIAYVGATILDVC
KRVRKKTLVGGNHQSGIRGDAK

Vial Size 100 µl
Concentration 0.05 mg/ml
Raised in Rabbit
Isotype IgG
Clonality Polyclonal, mono-specific.
Purity Affinity purified using the PrEST antigen as affinity ligand.
Species reactivity Human (Not tested in other species).
Interspecies information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000058594 (98%)
Rat ENSRNOG00000018549 (98%)
Appearance Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide.
Material Safety Data Sheet
Storage For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
Handling The antibody solution should be gently mixed before use.
Shipping Shipped at ambient temperature.
Price €315  Freight costs
Availability Available in stock