Add-to-cart Printer friendly view

Anti-GPKOW


Product name Anti-GPKOW
Product number HPA001894
Lot Number A08855
Description G patch domain and KOW motifs
Database links Human Protein Atlas: ENSG00000068394
Ensembl: ENSG00000068394
Uniprot/SWISSPROT;Acc:Q92917
HGNC Symbol;Acc:30677
Alternative names GPATC5, GPATCH5, Spp2, T54
Tested Applications

Immunohistochemistry-Paraffin Embedded Tissues (IHC-P)

IHC-P Anti-GPKOW
Hpa001894_t
Magnify Click the image to magnify

Immunohistochemical staining of human pancreas shows strong nuclear positivity in exocrine glandular cells and islet cells.

Recommended conditions:

  • Retrieval method: HIER pH6
  • Dilution: 1:50 - 1:200

Protocol IHC-P

Optimal concentrations and conditions should be determined by the end user.

Link to all IHC characterization data on the Human Protein Atlas

NOTE: Please visit the Human Protein Atlas for the images of the immunohistochemical analysis of 576 human tissue samples of normal and cancer origin as well as 59 cells and cell lines in duplicates.

Western Blot (WB)

WB Anti-GPKOW
HPA001894

Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil

Recommended conditions:

  • Dilution: 1:250 - 1:500

Protocol WB

Optimal concentrations and conditions should be determined by the end user.

Link to WB characterization data on the Human Protein Atlas

Immunoflouroscence (IF)

IF Anti-GPKOW
Hpa001894_t
Magnify Click the image to magnify

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.

Antibody staining is shown in green.

Recommended conditions:

  • Fixation/Permeabilization: PFA/Triton X-100
  • Working concentration: 1-4 µg/ml

Protocol IF

Optimal concentrations and conditions should be determined by the end user.

NOTE: Please visit the Human Protein Atlas for the images of the immunofluorescence analysis of three different cell lines stained with the antibody as well as with probes, displayed as different colors/channels, targeting specific intracellular compartments.

Link to all IF characterization data on the Human Protein Atlas

Protein Array (PA)

Anti-GPKOW shows specific reactivity against target antigen.

Protocol PA

References

Aksaas AK et al
G-patch domain and KOW motifs-containing protein, GPKOW; a nuclear RNA-binding protein regulated by protein kinase A.
J Mol Signal 2011 Aug 31;6(1):10
PubMed ID: 21880142
DOI: 10.1186/1750-2187-6-10

Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MPRPDEEQEKDKEDQPQGLVPGGAVVVLSGPHRGLYGKVEGLDPDNVRAM
VRLAVGSRVVTVSEYYLRPVSQQEFDKNTLDLRQQNGTASSRKTLWNQEL
YIQQDNSERKRKHLPD
Vial Size 100 µl
Concentration 0.2 mg/ml
Raised in Rabbit
Isotype IgG
Clonality Polyclonal, mono-specific.
Purity Affinity purified using the PrEST antigen as affinity ligand.
Species reactivity Human (Not tested in other species).
Interspecies information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000031148 (66%)
Rat ENSRNOG00000022939 (68%)
Appearance Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol, and 0.02% sodium azide.
Material Safety Data Sheet
Storage For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
Handling The antibody solution should be gently mixed before use.
Shipping Shipped at ambient temperature.
Price €315  Freight costs
Availability Available in stock